SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031891 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031891
Domain Number 1 Region: 356-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000298
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 594-665
Classification Level Classification E-value
Superfamily EF-hand 0.0000761
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031891   Gene: ENSCJAG00000017347   Transcript: ENSCJAT00000033708
Sequence length 805
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:87561326:87601018:-1 gene:ENSCJAG00000017347 transcript:ENSCJAT00000033708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVESPEGQELQKLGSGAWDNPAYSGPPSPHGTLRVCTISSTGLPQPQPKKTEDIPEET
AHRTRVSRCCLLICRGIRGLWGTTLTENTAENRELYVKTTLRELLIYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTASDTGVSFQAISSMADFWDFAQGPLLDSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLKVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPL
NGTAWTYHSQEELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEVLRDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIVGCEVVFC
VFIFYYVVEEILELHIHRLHYLRSIWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPNMYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFIKCIFTQFRIILGDFDYNAIDKANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLKQGYNKTLLRLRLRKE
RVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDKKEQEQ
MRQDLEEERVTLNTEIENLGRSIVSSPQGESSAEAARAGGWISEEEFYMLTRRVLQLETV
LEGVVSQVDAVGSKLKMLERKGWLAPSPGVEEQALWKHLQPAPAVTPDPWGVHCGQESDV
LYKREESLEERRLPCGKIPVLQSSY
Download sequence
Identical sequences F7I7J9
ENSCJAP00000031891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]