SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032213 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032213
Domain Number 1 Region: 394-525
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.36e-17
Family RecA protein-like (ATPase-domain) 0.053
Further Details:      
 
Domain Number 2 Region: 239-334
Classification Level Classification E-value
Superfamily DNA primase core 0.0000732
Family Primase fragment of primase-helicase protein 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032213   Gene: ENSCJAG00000017487   Transcript: ENSCJAT00000034052
Sequence length 531
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:88281304:88287482:1 gene:ENSCJAG00000017487 transcript:ENSCJAT00000034052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVLLRGGNPLRIFLPQRGEWMGRRGLPRGLAPGPPRRRYRKKALPALEIPVLPVTVTEI
RQYLRGRGIPFQNGHSCLRTPSPFVESSQLKDQTAVTTSFSLYIDKTTGRFLCMTSLAEG
SWEDFQASVEGGGDGASEGLLLSKAPEVEDSEEVRRIWNRAVPLSELPDPEEVQLAYTMF
GLTNITDDTLKRFSVRYLRPARSLVFPWFSPGGSGLRGLKLLQAKCQGDGVSYEETTIPQ
PSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTGLPTLTLPQGTSCLPPALLPYLEQ
FRRIVFWLGDDLRSWEAAKLFARKLNPKRCSLVRPGDQQPRPLEALNRGLNLSRILRTAL
PAWHKSIVSFRQLREEVLGELSNVEQAAGLPWSRFPDLNRILKGHRKGELTVFTGPTGSG
KTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAERRLEDQLDKYDHWADRFED
LPLYFMTFHGQQGIRTVVDTMQHAVYVYDICHVVIDNLQFMMGHEQLSTDR
Download sequence
Identical sequences F7ET10
ENSCJAP00000032213 ENSCJAP00000032213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]