SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032302 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032302
Domain Number 1 Region: 187-274
Classification Level Classification E-value
Superfamily POZ domain 7.85e-21
Family BTB/POZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 41-126
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000149
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032302   Gene: ENSCJAG00000017530   Transcript: ENSCJAT00000034143
Sequence length 283
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:128386939:128456810:1 gene:ENSCJAG00000017530 transcript:ENSCJAT00000034143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGEGSAARTVLLGSTEVCSKGLQRKGQCERRRLKAMVSEQLSQDLLRLLREEFHTDV
TFSVGCTLFKAHKAVLLTRVPDFYFHTVGQTSNSLTNHEPVAVENVEASEFRTFLQVIYS
SNRNVKNYEEEILRKKIVEIGISQKQLDINFPKSKNSSDCSLQKHEIPEDISDRDDLISN
DNYDLDPASELGEDLLKLYVKPCCPDIDFFVDGKRFKAHRAILRARSSYFAAMLSGCWAE
SSQEYVSLQGISHVEMNVMMHFIYGGTLDIPDKANIGLFPEHW
Download sequence
Identical sequences F7H1R5
ENSCJAP00000032302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]