SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032313 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032313
Domain Number 1 Region: 382-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.78e-63
Family Protein kinases, catalytic subunit 0.00000113
Further Details:      
 
Domain Number 2 Region: 252-340
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-31
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 14-101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-21
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032313   Gene: ENSCJAG00000017532   Transcript: ENSCJAT00000034155
Sequence length 879
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01178114.1:2633:32591:1 gene:ENSCJAG00000017532 transcript:ENSCJAT00000034155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAGYFLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTE
YGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSQNNNFQDDYHEDGICQ
PYQGIACACFIGNWTIYVDSLQMQGLAGSAVAFTMIGTSTHLSDQCSQFAIPSFCHFVFP
LCDARSRELCRDECEVLESDLCCQEYTIARSNPLILMRLQLPKWEALPMPESPDAANRMR
IGIPAEGLGRYHQCYNGSGTDYRGTASTTKSWHQCQPWALQHPHSHRLSSADFLELGGGH
AYCRNPGGQVEGPWCFTQNKNICMELCDVPSCSPRDSSMMGILYILVPSIAIPLVIACLF
FLVCMCGNKQKPSASMLQRRQLMASPSQDMEMPLINQHKQAKLKEVSLSAVRFMEELGED
RFGKVYKGHLLGPAPGEQTQSVAIKTLKDKADRPLREEFWHKATLRAWLQHPSIVCLLSV
VTKEQPLSMIFSYCSGDLHEFLVMRSLHSDVGSADDDCMVKSALEPRDFVLLVVQIAAGM
EYLSSHHMVHKDLATRNVLVYDKLTMKISDLGLFREVYAADYYKLLENSLLPIRWMAPEA
ITYWKFSIDSDIWSYGMVLWEVFSYGLQPYCGYSNQDVVEMIRNQQVLPCPNNCPTWVYA
LMIECRNEFPSQWPSFKDIHSQLRAWGNLSNYNSSAQTSGASNTTQTNSLSTSPVNNLSN
DCYVGPKQKAPSFPQPQFMPMKGQIRPMVPPPQLYVPVNGYQPVPAYAAYLPNFYPVQIP
MQMAPQQVPPQMLPKPSSHHSGGSSSTGYVTTAPSNTSMADRAALLSKGTKDSQNTPEDG
TQIPVQEAEEEKECSVPETELLGDSDTLQVDKAQVQLEA
Download sequence
Identical sequences H9KXB9
ENSCJAP00000032313 ENSCJAP00000032313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]