SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032319 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032319
Domain Number 1 Region: 249-521
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-36
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 2 Region: 7-109,158-326
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.3e-30
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032319   Gene: ENSCJAG00000017438   Transcript: ENSCJAT00000034161
Sequence length 526
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:114088309:114307248:-1 gene:ENSCJAG00000017438 transcript:ENSCJAT00000034161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATAPSIHIWDAMNKQTLSILRCYHSKGVCSVSFSATGKLLLSVGLDPEHTITIWRWQE
GAKIASRAGHNQRIFVAEFRPDSDTQFVSVGVKHVKFWTLAGRALLSKKGLLSTLEDARM
QTMLAIAFGANNLTFTGTISGDVCVWKDHILCRIVARAHNGPVFAMYTTLRDGLIVTGGK
ERPSKEGGAVKLWDQELRRCRAFRLETGQATDCVRSVCRGKGKILVGTRNAEIIEVGEKN
AACNILVNGHVDGPIWGLATHPSRDFFLSAAEDGTVRLWDIADKKMLNKVNLGHAARTVC
YSPEGDMVAIGMKNGEFIILLVSSLKIWGKKRDRRCPIHDIRFSPDSQYLAVGSSENSVD
FYDLTLGPTLNRISYCKDIPSFVIQMDFSADSRYLQVSSGCYKRHVYEVPSGKHMDHAAI
DRITWATWTSILGDEVLGIWSRHAEKADVNCACVSHSGISLVTGDDFGMVKLFDFPCPEK
FAKHKRFLGHSPHVTNIRFTSGDRHVVSAGGDDCSLFVWKCVHMPH
Download sequence
Identical sequences F7GWJ3
ENSCJAP00000032319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]