SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032384 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032384
Domain Number 1 Region: 213-468
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-50
Family Voltage-gated potassium channels 0.0016
Further Details:      
 
Domain Number 2 Region: 50-159
Classification Level Classification E-value
Superfamily POZ domain 2.04e-24
Family Tetramerization domain of potassium channels 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032384   Gene: ENSCJAG00000017576   Transcript: ENSCJAT00000034227
Sequence length 529
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:39247056:39252107:-1 gene:ENSCJAG00000017576 transcript:ENSCJAT00000034227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLLVRGTRYENHRSKVTLPTPLGGESNEATVCESPGPDTGIRWRRSDEALRVNVGGVR
RLLSARALARFPGTRLGRLQAAASEEQARRLCDDYDAAACEFYFDRHPGFFLGLLHFYRT
GHLHVLDELCVFAFGQEADYWGLGENALAACCRARYLERRVTRPRAWDEDSDTPSSVDPC
PDEISDVQRELARYGAARCGRLRRRLWLTMENPGYSLPSKLFSCVSISVVLASIAAMCIH
SLPEYQAREAAAAVAAVAAGRSAEGVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNF
FCHPLNLIDIVSVLPFYLTLLAGAALGDDGGTGGKEFGHLGKVVQVFRLMRIFRVLKLAR
HSTGLRSLGATLKHSYREVGILLLYLAVGVSVFSGVAYTAEKEEHVGFDTIPACWWWGTV
SMTTVGYGDVVPVTVAGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRNS
NHQEFEDLLSSVDGVSEASLETSRETSQEGRSADLETQAPSEPPHSQMY
Download sequence
Identical sequences F7FJE7
ENSCJAP00000032384 ENSCJAP00000032384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]