SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032579 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032579
Domain Number 1 Region: 21-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.35e-111
Family Homocysteine S-methyltransferase 0.0000129
Further Details:      
 
Domain Number 2 Region: 782-1109
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 5.36e-111
Family Methionine synthase SAM-binding domain 0.0000000861
Further Details:      
 
Domain Number 3 Region: 371-537
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.49e-44
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0022
Further Details:      
 
Domain Number 4 Region: 623-775
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.44e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000273
Further Details:      
 
Domain Number 5 Region: 519-608
Classification Level Classification E-value
Superfamily Methionine synthase domain 5.62e-27
Family Methionine synthase domain 0.0000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032579   Gene: ENSCJAG00000017612   Transcript: ENSCJAT00000034434
Sequence length 1118
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:43444264:43598648:-1 gene:ENSCJAG00000017612 transcript:ENSCJAT00000034434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALQDLSQPAGLKKTLWNEIDAILQKRIMVLDGGMGTMIQRHKLNEEHFRGQEFQDHA
RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYQMNKC
SAGVARKAAEEITLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVGAYQEQA
RGLLDGGVDILLIETIFDTANAKAALFALQKLFEETYAPRPIFISGTIVDKSGRTLSGQT
GEAFVINVSHADPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPDAVFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDINMDDG
MLDGPSAMTQFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEED
FLEKARKIRKFGAAVVVMAFDEEGQTHGQGGKKVIQTDEWRNGPVEERLEYALVKGIEKH
IIEDTEEARLNQEKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGH
LIPFMEKEREETRVLNSTIEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDL
GVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRT
HTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKD
RRYLPLNQARKSGFRMDWLSEPHPVKPTFIGTQVFEDYDLQRLVDYIDWKPFFDVWQLRG
KYPNRGFPKIFNDKTVGEEAKKVYDDAQNMLNSLISQKKLQARGVVGFWPAQSVQDDIHL
YAEGAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFG
VEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRL
RYEGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRLTESLAMAPAAAVSGLYFSNLKSK
YFAVGKISKDQVEDYALRKNMSVAEIEKFNFVHYKIGE
Download sequence
Identical sequences F7FWS1
ENSCJAP00000032579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]