SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032728 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032728
Domain Number 1 Region: 605-682
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000474
Family HLH, helix-loop-helix DNA-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032728   Gene: ENSCJAG00000017751   Transcript: ENSCJAT00000034590
Sequence length 798
Comment pep:novel chromosome:C_jacchus3.2.1:14:14540027:14542671:-1 gene:ENSCJAG00000017751 transcript:ENSCJAT00000034590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEDNDDSDTDEPSPGLGRDEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQT
YSFGKTSSCHLSVDTSPTKLFKCMTLAYSGKLVSPKWKNFKDLKLQWRDKIWLNNAIWRA
WYMQCLEKGKNPVTPLDGSVDVEKHCRPEAITTEEKYWKSRMEIVIREYHKWRTYFKKRL
QQHKDEDLSSLAQDYDMLYWHKHRDGWKTPIPIEEHPLLDTDMLMSEFIHTLFSRLSSHQ
PVEIANLGNADMIQPGLMPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPAPASTPVPDSN
NPPAQESILHTTTLPTMSLPDSIIEPHAAPSLDPVDGQVCEHASQTEDPFIQPTDFSTSE
PPLSVPQPFLPVFTMPLLSPSPAPPPVSPLLLIVPPQPLPNRRLSSPTQPSPPSPMMPPP
PPSASPSPCPTVNPCGLTLSPVTRPPQPQLTSVHPKPVSLMGGRPKQPHKIVPAPKPEPV
SLVLKNTCITPAPFSGQPQAVIMTSGPLKREGMLASTVSQSNVVIAPAAIARAPGVPEFH
SSILVSSQAQHKTLGKAEQVPLHGGSPQVTVTGPSLDCPNSGQASQCTSEQSPSPQFPQN
NCSEKNRQMKHISAEQKRCVNIKMGDALNILISNNSRLTSHAITLQKTMEYITKLQQERG
QMQEEARRLREEIELNAAIISCQQLFPATGVPVTQFNHMRDMFDEYVKSQTQNWNFWIFS
IIIKPLFESFKGMVSISSLEELHCTALSWLDQHCSLPILRPMVLNTLRQLSTSSPILTDP
AQLPEQASEALTRIGKRL
Download sequence
Identical sequences F7GW15
ENSCJAP00000032728 ENSCJAP00000032728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]