SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032904 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032904
Domain Number 1 Region: 74-290
Classification Level Classification E-value
Superfamily FKBP-like 1.39e-30
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032904   Gene: ENSCJAG00000017793   Transcript: ENSCJAT00000034775
Sequence length 1351
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:156601725:156652858:-1 gene:ENSCJAG00000017793 transcript:ENSCJAT00000034775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGSGDEDDTDFLSPSGGARLASLFGLDQAAAGHGNEFFQYTAPKQPKKGQGTGATGNQA
TPKTAPTTTSTSTILVATAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYRILLYISQQQT
VTVARIHVNFELTVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDA
VLSQDLIVTEGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKG
WEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGH
SVSSRDSAAPSPIPGADNLSADPVVSPPTSMPFKPGEPALRTKSNSLSEQLTINTSPDAV
KAKLISRMAKMGQPMLPILPPQLDSNDSETEDVNALRGGGQPMVTPSVQPSLQPAHPALP
QLTSQAPQPSVSGLQAPSAALMQVASLDSHSAVSGNAQSFQPYAGMQAYAYPQASAVTSQ
LQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEEL
QKHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQELLEKSNRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMT
AHQKKETELQMQLTENLKETDLLRGQLTKVQAKLSELQETSEQAQSKFRSEKQSRKQLEF
KVTSLEEELTDLRAEKESLEKNLSERKKKSAQERCQAEEEIDEIRKSYQEELDKLRQLLK
KTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDTQQQKLVQ
LQEKCLALQAQITALTEQNEQHIKKLEKNNSQMPGIEAAVSDPSEKVKKIMNQVFQSLRT
EFELEESYNGRTILGTIMNTIKMVTLQLLNQQEREKEESSSEEEEKVEEQPRGPSQQQSA
SASSRQPGAPLNRERPESPMVPLEQVVEEAAPLPPQALTTSQDDVHGRKGDSEAEVLSEI
KDGSLPPERPCIPSHRVSGPPESIPPEPPGSVTMDFECEETLAASPMAAKPDSPSGKVCV
REVAPEGPLQESSTRLSLSSDPKKGDPLALGPESLGEPQPPELKKDDVTSSAGPREELLS
TEAGSTVAGPALRPSHHSQHSSLSGDEEDELFKGATLKALRPKAQPEEEDEDEVVRKSQA
LPSPHTASWGLFPTGSEKRNGVCWWPPPWTLCAGPCGSRLRAGLGGCSSVSRVGSHTALL
LRKNHSLCPCRNYSPERRSARILFSHFDCSEMQQKAVMDLRSSSYVPEPFPLACVFGNVP
VPSISLSSQELNFHLRIQNTNPALKKGKNGG
Download sequence
Identical sequences F7H619
ENSCJAP00000032912 ENSCJAP00000032904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]