SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033335 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033335
Domain Number 1 Region: 442-632
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.39e-54
Family cAMP-binding domain 0.00000000951
Further Details:      
 
Domain Number 2 Region: 314-481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-20
Family Voltage-gated potassium channels 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033335   Gene: ENSCJAG00000018037   Transcript: ENSCJAT00000035223
Sequence length 857
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:15664746:15698250:-1 gene:ENSCJAG00000018037 transcript:ENSCJAT00000035223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPSQARPPPPPSPRPLRGCPFKKPRTSCRHPLASRSPASRSRWGPRRAPWTRKRTPRRR
GPGTATTPAAGTSSCGPCALPSPSTAAGDAVYRSSALGAADSEGPARGPVEGGAAAGDQI
LPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSD
FRHHWELVGIFVLVEDLFIILTGKRYPSVQTHTVWHLISGVTEGFLRWDQFVSLRIPLAL
REHLTTIADPELLKPYHTLCAMFIAEIVVQANLDKDPILEEKGLGSEGSQTCQVHLSVTE
VKVGSSPRLVLGALMLRDLWPWQRIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLV
PMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSM
IVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRY
QGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPG
DYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGEICLLTRGRRTASVRADTYC
RLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQEN
EIIQQIVQHDREMAHCAHRVQAAASATPTPTPVIWTPLIQAPLQAAAATTSVAIALTHHP
RLPAAIFRPPPGPGLGNLGAGQTPTPPHPPGPVAPPPLPHHQPLQPPPPQRRGTPPLTPG
RLTQDLKLISASQPALPQDGAQTLRRASPHSSGSLPPPLSLFGARATSSGGPPLTAGPQR
EPGARPEPVRSKLPSNL
Download sequence
Identical sequences F6TTS6
ENSCJAP00000033335 ENSCJAP00000033335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]