SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033361 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033361
Domain Number 1 Region: 4-32,84-152
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.88e-23
Family Voltage-gated potassium channels 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000033361
Domain Number - Region: 231-271
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00275
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033361   Gene: ENSCJAG00000018060   Transcript: ENSCJAT00000035250
Sequence length 396
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:119851022:119857898:1 gene:ENSCJAG00000018060 transcript:ENSCJAT00000035250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL
LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC
IFYALVGIPLFGILLAGVGDRLGSSLRRGIGHIEAIFLTPGPRAPCTLNTYVKCTLTRVT
LCTGAHLLSHAFIWYTFNSCTPLVVEHALYTRPSLSAFTGGIPGADPRQDSPAYQPLVWF
WILLGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPL
EKERPLLPPPPCPAQPLVRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSER
GCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKDVPV
Download sequence
Identical sequences F6T658
ENSCJAP00000033361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]