SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033411 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033411
Domain Number 1 Region: 26-114
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 103-176
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.96e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033411   Gene: ENSCJAG00000018082   Transcript: ENSCJAT00000035302
Sequence length 193
Comment pep:novel chromosome:C_jacchus3.2.1:1:171365202:171368860:-1 gene:ENSCJAG00000018082 transcript:ENSCJAT00000035302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSARRRPRCNFLRSSRIWVHPTPATSTMPPKFDPNEIKVVYLRCTGGEVGATSALAPKI
GPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDR
KKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDII
DDINSGAVECPAS
Download sequence
Identical sequences F6RXN0
ENSCJAP00000033411 ENSCJAP00000033411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]