SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033413 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033413
Domain Number 1 Region: 45-116
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 3.01e-17
Family Ribosomal protein L11, C-terminal domain 0.0079
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000497
Family Ribosomal L11/L12e N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033413   Gene: ENSCJAG00000033798   Transcript: ENSCJAT00000035304
Sequence length 133
Comment pep:novel chromosome:C_jacchus3.2.1:7:51349358:51349849:1 gene:ENSCJAG00000033798 transcript:ENSCJAT00000035304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKFDPSEIKVVYLRYTGGVSATSMLAPKIGTLGLSPKKIEVVPFASALIIKALKEPPR
KKQKNIKHSGNVTFDEIVTIAQQMWHRSLAREPSGTIKEILETAQSVGCNVDGRHPHYII
DDVNSGAVKCPAS
Download sequence
Identical sequences F6RMU6
ENSCJAP00000033413 ENSCJAP00000033413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]