SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033441 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033441
Domain Number 1 Region: 1917-2193
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.41e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000236
Further Details:      
 
Domain Number 2 Region: 1-231
Classification Level Classification E-value
Superfamily Thiolase-like 9.52e-63
Family Thiolase-related 0.0038
Further Details:      
 
Domain Number 3 Region: 486-611,674-771
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.68e-41
Family FabD-like 0.0059
Further Details:      
 
Domain Number 4 Region: 204-399
Classification Level Classification E-value
Superfamily Thiolase-like 9.12e-33
Family Thiolase-related 0.0015
Further Details:      
 
Domain Number 5 Region: 1549-1668
Classification Level Classification E-value
Superfamily GroES-like 3.14e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0052
Further Details:      
 
Domain Number 6 Region: 1637-1698
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.87e-16
Family Alcohol dehydrogenase-like, C-terminal domain 0.0055
Further Details:      
 
Domain Number 7 Region: 1205-1396
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000677
Family UbiE/COQ5-like 0.026
Further Details:      
 
Domain Number 8 Region: 1818-1882
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000122
Family Acyl-carrier protein (ACP) 0.00011
Further Details:      
 
Domain Number 9 Region: 611-667
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000432
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 
Domain Number 10 Region: 1701-1764
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00000869
Family Tyrosine-dependent oxidoreductases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033441   Gene: ENSCJAG00000018059   Transcript: ENSCJAT00000035332
Sequence length 2203
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:131245998:131264078:-1 gene:ENSCJAG00000018059 transcript:ENSCJAT00000035332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGPRRSGKKDLSRFDA
SFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPASLRGTHTGVWVGVSGSEASEALSR
DPETLLGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLLALHNAYEAIRSGVCPA
AIVGGINVLLKPNTSVQFMRLGMLSPEGACKAFDEAGNGYCRSEAVVVFLMTLIPGPTGV
GTIFNAGTDTDGLIHKGGCPEAIYPLLVRAWSDRPRIREKIMKSTSSPQSRRSVGDPQEL
GIVQALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFHNPNPEI
PALLDGRLQVVEQPLPVRGGNVGINSFGFGGSNVHVILKPNTQPPPAPAPHATLPHLLRA
SGRTAEAVQELLEQGLQHSQDLAFLSMLNNIAAAPATAMPFRGYAVLGGESGGPEVQQVP
TGERPVWFICSGMGTQWRGMGLNLMRLSLFRDSILRSDEAVKPLGLKVSQLLLSTDESTF
DDIVHAFVSLTAIQIGLIDLLSCMGLRPDGIIGHSLGEVACGYADGCLSQEEAVLSAYWR
GQCIKEANIPKGAMAAVGLSWEECKQRCPPGVVPACHNSEDTVTISGPQGPVHEFVEQLK
QEGVFAKEVRTGGMAFHSYFMEGIAPPLLRALKKVIREPKPRSARWLSTSIPEAQWHTSL
AHTCSPEYNVNNLVSPVLFQEALGHVPEHAVVLEIAPHALLQAVLKRGLKPSCTIIPLMK
KDHRDNLELFLTGIGKLHLSGIDANPNALFPPVEFPVPRGTPLISPLIKWDHSLAWDVPA
AEDFPNGSGSPSASVYTIDASPESPDHYLVDHRIDGRVIFPATGYLCLVWKTLARALGLA
VEQLPVVFEDVVVHQATILPKTGTMSLEVRLLEASHTFEVSESGHLIVSGKVYQWEDPDP
RLFDHPESPTPSPGEPFFLAQAEVYKDLRLCGYDYGPHFQGILEASLDGNSGKLLWKDNW
VPFLDAMLQMSILSKSQRSLLLPTRITAIHIDPATHRQKLYTQQDKAQVADVVVSRCLKT
TVAGGVHVFLLHASAAPRRQQEQQAPILEKFCFTPHVEDGCLSGNTALKEELRLCKGLVQ
ALQTKVTQQGLKMAVPGLDGAQVPQDLPQQALPQLLSAACGLQLNGNLQLELAQLLAQER
SELPEDPLLSGLLDSPALKACVDTALENMPSLKMKVVEVLAGHGHLYSRIPGLLNTQPLL
QLSYTATDRHPQALEAAHAKLQQHDIAQGQWDPSDPAPSALGSTDLLVCNCAVAALGDPA
SAVGNMVAALREGGFLLLHTLLQGHPLGETVAFLTSAEPQYAQGILSQDAWESLFAKMSL
RLVGLKKSFYGSVLFLCRRPAPQDSPIFLPVEDTSFRWVDSLKGILADSSSRPVWLKAIN
CTTSGVVGLVNCLRQEPGGHRIRCLLLSNLSSTSRVPDVDPGSAELQKVLQGDLVMNVYR
DGAWGAFRHFPLEQDKPEELTAHAYVMVLTRGDLSSIRWVCSSLRLAQPASPGGAQLCTV
YYASLNFRDIMLATGKLSPDAIPGKWATKDCLLGMEFSGRDASGKRVMGLVPAEGLATSV
LLSPDFLWDVPSHWTLEEAASVPVVYTTAYYALVVRGRVQRGETVLIHSSGGVGQAAIAI
ALSLGCRLVGSDTCDHRVTREACPELDYFVVFSSVSCGRGNAGQTNYGFANSTMERICEK
RRHDGLPGLAVQWGAIGDVGIVLEAMGTNDTVIGGTLPQRMASCLEVLDLFLNQPHAVLS
SFVLAEKAASYKDGDGRRDLVKAVAHILGIRDLAGVNLDSSLADLGLDSLMGVEVRQTLE
REHDLALSMREVRQLTLRKLQELSSKAGAASKLASPTPKNSPAHLQSQLNLRSLLVNPEG
PTLTRLNSVQSSERPLFLVHPIEGSTVVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAY
YIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTNNSLFLFDGSHTYVLAYT
QSYRAKLTPGCEAEAETEAMCFFVQQFTDAEHSRVLEMLLPLKGLEERVAAAVDLITKSH
QALDRQELSFAALSFYYKLRAAEQYTPKAKYHGNVTLLRAKTSGAYGEDLGADYNLSQVC
DGKVSVHIIEGDHRTLLEGRGLESIISIIHSSLAEPRVSVREG
Download sequence
Identical sequences F6RA19
ENSCJAP00000033441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]