SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033500 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033500
Domain Number 1 Region: 29-137
Classification Level Classification E-value
Superfamily FKBP-like 8.45e-40
Family FKBP immunophilin/proline isomerase 0.000076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033500   Gene: ENSCJAG00000018124   Transcript: ENSCJAT00000035391
Sequence length 140
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:119794625:119797415:1 gene:ENSCJAG00000018124 transcript:ENSCJAT00000035391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWVQVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQPFVFSLGTGEVIKGWDQGLLGMCEAEKSKLVIPSKLGYGELGAPPKIP
GGATLVFEVELLKIERRSEL
Download sequence
Identical sequences F6PIX3
ENSCJAP00000033500 ENSCJAP00000033500 ENSCJAP00000033504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]