SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033717 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033717
Domain Number 1 Region: 14-49,98-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-24
Family Voltage-gated potassium channels 0.0059
Further Details:      
 
Domain Number 2 Region: 162-289
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-22
Family Voltage-gated potassium channels 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033717   Gene: ENSCJAG00000018218   Transcript: ENSCJAT00000035621
Sequence length 336
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:46543907:46600438:-1 gene:ENSCJAG00000018218 transcript:ENSCJAT00000035621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVA
IVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS
FSSITDQAAGMKEDQKQNEPFVAAQSSACVDGPVNH
Download sequence
Identical sequences F6U0J3
ENSCJAP00000033717 ENSCJAP00000033717 XP_002760849.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]