SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033905 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033905
Domain Number 1 Region: 7-183
Classification Level Classification E-value
Superfamily RNI-like 1.35e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033905   Gene: ENSCJAG00000018275   Transcript: ENSCJAT00000035820
Sequence length 210
Comment pep:novel chromosome:C_jacchus3.2.1:2:167419077:167452541:-1 gene:ENSCJAG00000018275 transcript:ENSCJAT00000035820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPLAEHFSNLAQNSNLVRLNLCGCSGFSEFALQTLLSGCSRLDELNLSWCFDFTEKHV
QVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSIMLKNDCFPEFFQL
NYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIDNQKNQEIWGIKCRLTLQKPSCL
Download sequence
Identical sequences A0A2K5CRJ2 F6PGR6
ENSCJAP00000033905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]