SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034099 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034099
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 1.07e-81
Family Integrin A (or I) domain 0.000000318
Further Details:      
 
Domain Number 2 Region: 375-481
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-25
Family Integrin domains 0.0039
Further Details:      
 
Domain Number 3 Region: 644-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000824
Family Integrin beta tail domain 0.0087
Further Details:      
 
Domain Number 4 Region: 43-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000209
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 602-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Integrin beta EGF-like domains 0.0081
Further Details:      
 
Domain Number 6 Region: 560-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family Integrin beta EGF-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000034099
Domain Number - Region: 531-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0148
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034099   Gene: ENSCJAG00000018387   Transcript: ENSCJAT00000036023
Sequence length 798
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:42052833:42062156:-1 gene:ENSCJAG00000018387 transcript:ENSCJAT00000036023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTLPIVVVLLLVLSRGESELDAKIPSTGEATKWGNPHLSLLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEERRCAGREELLARGCPPAELEEPRGRQEVLQDQPLGQGTRGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTRSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTADAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSTALPVYEELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSPLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVNFWVTLQATHCLPEPHLLRLRALGFSEELTVELHTLCDCNCSD
TQPHVPHCSDGQGHLQCGVCSCAPGRLGRLCECSEAELSSSDLESGCRAPNGTGPLCSGR
GQCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHGNRTGRACECSG
DMDSCISPEGGLCSGHGLCKCNRCQCSDGYYGALCDQCPGCKTPCERNRDCAECGAFGTG
PLATNCSTACAHTNVTLALAPFLDDGWCKERTLDNQLFFFLVEDEARGRVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLLVEIYDRREYSRFEKERQQLNWKQDSNPLYKS
AITTTINPRFREADSPTL
Download sequence
Identical sequences F6ZB10
ENSCJAP00000034095 ENSCJAP00000034099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]