SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034362 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034362
Domain Number 1 Region: 954-1156
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000027
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000034362
Domain Number - Region: 499-552
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00235
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034362   Gene: ENSCJAG00000018448   Transcript: ENSCJAT00000036294
Sequence length 1315
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:106454775:106602382:1 gene:ENSCJAG00000018448 transcript:ENSCJAT00000036294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVEL
ELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKA
KNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSR
IRKERPISLGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQPRSHTSLKCPQDELSD
VSQGGSKATTPASTANSDVATIPPDTPLKEENEGFVKITDTPNKSEISKHIEVQVAQETR
NVSTAPAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEEL
SSAGSGLIGDVDEGADLLASFLIKPDWYIGMGREVENLILENTQLLETKNALNIVKNDLI
AKVDELTCEKDVLQGELEAVKQAKLKLEEKNKELEEELRKARAEAEDARQKAKDDDDPIS
SYCCEHTSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQ
EKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSK
AFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVIYVTNGQG
ENKMKNLPVPVYLRPLDEKDTSMKKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDT
EGSEQRSASQSSLDKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGNILDSFTV
CNSHVLCIASVPGARETDYPAGEDLSESVTSNSSAETDSLLGGITVVGCSAEGVTGAATS
PSTNGASPVMEKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHV
FTDPLGVQIPEDLSPVYQSSNDSDAYKDAISVLPNEQDLVREEAQKMSSLLPTMWLGAQN
GCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNY
HLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWV
GDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRL
WVGTGNGVIISIPLTETVILHQGRLLGLRANKTSGVPGNRPGSVIRVYGDENSDKVTPGT
FIPYCSMAHAQLCFHGHRDAVKFFVAVPGINSLASSSSGTDLTGEKAGPSAQEPGSQTPL
KSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGSE
Download sequence
Identical sequences F6XL45
ENSCJAP00000034362 ENSCJAP00000034362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]