SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034530 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034530
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000671
Family Glutathione peroxidase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034530   Gene: ENSCJAG00000018607   Transcript: ENSCJAT00000036466
Sequence length 71
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:500176:507445:-1 gene:ENSCJAG00000018607 transcript:ENSCJAT00000036466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHRDQKDTIYDYEAIMLNEKEYVPFKRYVGKHVLFVNVATYCGLTAQYPGMSVQGEDL
YLTSSFLRKEM
Download sequence
Identical sequences F7IAU8
ENSCJAP00000034530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]