SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034731 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034731
Domain Number 1 Region: 205-453
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 3-32,60-139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000011
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000034731
Domain Number - Region: 141-183
Classification Level Classification E-value
Superfamily PRTase-like 0.0122
Family Phosphoribosyltransferases (PRTases) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034731   Gene: ENSCJAG00000018639   Transcript: ENSCJAT00000036679
Sequence length 967
Comment pep:novel chromosome:C_jacchus3.2.1:5:106947820:107003418:-1 gene:ENSCJAG00000018639 transcript:ENSCJAT00000036679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRWVRH
KYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLLIVA
FFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRRLEKKRRNLMLDDVIASGSSASAA
SEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQPQILDEALKI
CNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEIEVNASLPINP
TIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFFIFAALGVELF
GDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDCDQESTCYNTV
ISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEMKTLSPQPHSP
MGSPFLWPGVEGPDSPDSPKPGALHPTAHARSASHFSLEHSTDRQLFDTISLLIQGSLEW
ELKLMDELAGPGGQPSAFPSAPSLGGSNPQIPLAEMEALSLTSEIVSEPSCSLALTDDSL
PDDTHTLLLSAPESNMQPHSTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGSTAEGSLG
HRDWGLPKAQSGSILSVHSQPADTSYILQLPKDAPHLLQPHSTTTWGTIPKLPPPGRSPL
AQRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQARQHSLGRS
KIPKHMPPPALHPGPEPSWDQGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKK
CYSVEAQSCQRRPVSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGPGSRPKKKLSPPS
ISIDPPESQGPRAPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSS
DPADLDP
Download sequence
Identical sequences F7IAQ0
ENSCJAP00000034731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]