SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034755 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034755
Domain Number 1 Region: 193-355,383-462
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-41
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 521-769
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-33
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034755   Gene: ENSCJAG00000018639   Transcript: ENSCJAT00000036705
Sequence length 1146
Comment pep:novel chromosome:C_jacchus3.2.1:5:106947820:107003418:-1 gene:ENSCJAG00000018639 transcript:ENSCJAT00000036705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPSSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDE
EESSEEERASPAGSDRRHRGSLEREAKSSFDLPGTLQVPGLHRTASGRGSASEHQDCNGK
SASGRLAQALRPDDPPLDGDDADDEGNLSKGERVRAWIRARLPACCLERDSWSAYIFPPQ
SRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAKRIFLTLSNYIFTAVFL
AEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRL
LRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQ
GEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVD
QQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRR
LEKKRRSKAQPDSVIFIKAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMA
MEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMG
ITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLL
FMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMK
DTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEA
ELELEMKTLSPQPHSPMMQPHSTELPGPDLLTVRKSGVSRTHSLPNDSYMCRHGSTAEGS
LGHRDWGLPKGSILSVHSQPADTSYILQLPKDAPHLLQPHSTTTWGTIPKLPPPGRSPLA
QRPLRRQAAIRTDSLDVQGLGSREDLLAEVSGPSPPLARAYSFWGQSSTQARQHSLGRSK
IPKHMPPPALHPGPEPSWDQGPPETRSSLELDTELSWISGDLLPPGGQEEPPSPRDLKKC
YSVEAQSCQRRPVSWLDEQRRHSIAVSCLDSGSQPHLGTDPSNLGGPGSRPKKKLSPPSI
SIDPPESQGPRAPPSPGICLRRRAPSSDSKDPLASGPPDSMAASPSPKKDVLSLSGLSSD
PADLDP
Download sequence
Identical sequences F7I601
ENSCJAP00000034755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]