SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035014 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035014
Domain Number 1 Region: 277-625
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.3e-87
Family YicI catalytic domain-like 0.0000605
Further Details:      
 
Domain Number 2 Region: 627-709
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.83e-22
Family Putative glucosidase YicI, domain 3 0.0077
Further Details:      
 
Domain Number 3 Region: 11-80,145-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000000107
Family YicI N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035014   Gene: ENSCJAG00000018826   Transcript: ENSCJAT00000036971
Sequence length 778
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:118301172:118324664:-1 gene:ENSCJAG00000018826 transcript:ENSCJAT00000036971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRIRIDELEPRRPRYRVPDVLVADPLTARLSVSGRDDNSVELTMAEGPYKIILTARPFR
LDLLEDRSLLLSVNARGLLHFEHQRAPRVSQGSKDPAEGDGAQPEETSQDGDKPEETQGK
AEKDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPY
RLYNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGK
MMDYLQGSGETPQTDVRWMSETGIIDTFLLLGPSISDVFRQYASLTGTQALPPLFSLGYH
QSRWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLA
SKRRKLVTIVDPHIKVDSGYRVHDELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTM
RSWWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDLHNIYGL
YVHMATADGLRQRSGGMERPFVLGRAFFAGSQRFGAVWTGDNTAEWDHLKISVPMCLSLG
LVGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSPYNDII
RDALNQRYSLLPFWYTLFYQAHREGIPVMRPLWVQYPQDVTTFSIDDQFLLGDALLVHPV
SDSGAHAVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVR
RSSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSR
Download sequence
Identical sequences F7IG37
ENSCJAP00000035014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]