SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035017 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035017
Domain Number 1 Region: 395-743
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.96e-87
Family YicI catalytic domain-like 0.0000605
Further Details:      
 
Domain Number 2 Region: 745-827
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-22
Family Putative glucosidase YicI, domain 3 0.0077
Further Details:      
 
Domain Number 3 Region: 263-392
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000000377
Family YicI N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035017   Gene: ENSCJAG00000018826   Transcript: ENSCJAT00000036974
Sequence length 949
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:118300359:118324649:-1 gene:ENSCJAG00000018826 transcript:ENSCJAT00000036974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRSWASLVLAFLGVCLGITLAVDRSNFKTCEESSFCKRQRSVRPGLSPY
RALLDSLQLGPDSLTVHLINEVTKVLLVLELQGPKNMTRIRIDELEPRRPRYRVPDVLVA
DPLTARLSVSGRDDNSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLHFEHQ
RAPRVSFSDKVSLTLGSIWDKIKNLFSRQGSKDPAEGDGAQPEETSQDGDKPEETQGKAE
KDEPGAWEETFKTHSDSKPYGPMSVGLDFSLPGMEHVYGIPEHADNLRLKVTEGGEPYRL
YNLDVFQYELYNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKMM
DYLQGSGETPQTDVRWMSETGIIDTFLLLGPSISDVFRQYASLTGTQALPPLFSLGYHQS
RWNYRDEADVLEVDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASK
RRKLVTIVDPHIKVDSGYRVHDELRNLGLYVKTRDGSDYEGWCWPGSAGYPDFTNPTMRS
WWANMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDLHNIYGLYV
HMATADGLRQRSGGMERPFVLGRAFFAGSQRFGAVWTGDNTAEWDHLKISVPMCLSLGLV
GLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSPYNDIIRD
ALNQRYSLLPFWYTLFYQAHREGIPVMRPLWVQYPQDVTTFSIDDQFLLGDALLVHPVSD
SGAHAVQVYLPGQGEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRS
SDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRQEFLLRRFSFSGNTLVSRYSVP
GDPTPAAVVLQSKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHLR
Download sequence
Identical sequences F7IG34
ENSCJAP00000035017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]