SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035085 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035085
Domain Number 1 Region: 47-96
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.00000903
Family Deoxycytidylate deaminase-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035085   Gene: ENSCJAG00000018856   Transcript: ENSCJAT00000037046
Sequence length 144
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:20793445:20796188:-1 gene:ENSCJAG00000018856 transcript:ENSCJAT00000037046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSLLMNQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKNGCHVELLF
LRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKA
EPEGLRRLHRAGVQIAIMTFKAPV
Download sequence
Identical sequences F7I8W6
ENSCJAP00000035085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]