SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035502 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035502
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035502   Gene: ENSCJAG00000019123   Transcript: ENSCJAT00000037491
Sequence length 331
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:43978703:43988742:1 gene:ENSCJAG00000019123 transcript:ENSCJAT00000037491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTYVKSKEMGELVNTPSWMDKSLGSQNEVKEEESRPGTYGVLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSASLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFSE
Download sequence
Identical sequences F7I8P5
ENSCJAP00000035502 ENSCJAP00000035502 XP_002752613.1.60252 XP_009002188.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]