SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035675 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035675
Domain Number 1 Region: 242-347
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.15e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 96-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.03e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 15-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000945
Family HLH, helix-loop-helix DNA-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035675   Gene: ENSCJAG00000019202   Transcript: ENSCJAT00000037674
Sequence length 830
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:86744718:86771845:1 gene:ENSCJAG00000019202 transcript:ENSCJAT00000037674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKGEKVLESKETISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGPVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDISPQVFT
KGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQ
TECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSN
DTETDDQQLEEVPLYNDVMLPSSNEKLQNINLSMSPLATSETPKPLRSSADPALNQEVAL
KLEPNPESLELSFTMPQIQDQPPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELV
EKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQ
STVTVFQQTQIQELTSNATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATS
SPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRATVPEEELNPKILALQNA
QRKRKIEHDGSLFQAVGIGTLLQQPDDHATTTSLSWKRVKGCKSSEQNGMEQKKVSLCFS
DLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Download sequence
Identical sequences F7GSH8
ENSCJAP00000035675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]