SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035750 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035750
Domain Number 1 Region: 152-313,351-401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-40
Family Voltage-gated potassium channels 0.0033
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000209
Family Flavin-binding PAS domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035750   Gene: ENSCJAG00000019255   Transcript: ENSCJAT00000037753
Sequence length 413
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:87881122:87941717:-1 gene:ENSCJAG00000019255 transcript:ENSCJAT00000037753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKTTIFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEKV
VLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSRL
AEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKTK
QNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSCL
PYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGLVAH
WLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSLYVS
SLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGCKYFNSFPQFSLLQSQIG
Download sequence
Identical sequences F7EVA1
ENSCJAP00000035750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]