SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035786 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035786
Domain Number 1 Region: 155-316,354-416
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 419-606
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.18e-41
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 6-74
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000126
Family Flavin-binding PAS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035786   Gene: ENSCJAG00000019255   Transcript: ENSCJAT00000037793
Sequence length 624
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:87619322:88039488:-1 gene:ENSCJAG00000019255 transcript:ENSCJAT00000037793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEH
EKVVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKH
SRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSF
KTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLL
SCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEYGAAVLVLLVCVFGL
VAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDSL
YVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSLLYATIFGNVTTIFQQMYANT
NRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLSICPKDMRADICV
HLNRKVFNEHPAFRLASDGCLRALAVEFQTIHCAPGDLIYHAGESVDALCFVVSGSLEVI
QDDEVVAILGKGDVFGDIFWKETTLAHACANVRALTYCDLHIIKREALLKVLDFYTAFAN
SFSRNLTLTCNLRKRGWFSMASAL
Download sequence
Identical sequences F7E3H5
ENSCJAP00000035786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]