SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035843 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035843
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 1.44e-51
Family Isochorismatase-like hydrolases 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035843   Gene: ENSCJAG00000019309   Transcript: ENSCJAT00000037851
Sequence length 196
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:76786335:76802959:-1 gene:ENSCJAG00000019309 transcript:ENSCJAT00000037851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPK
GLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALE
LVGRGVEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQ
NLIKASAPESGLLSKV
Download sequence
Identical sequences F7H7G8
ENSCJAP00000035843 ENSCJAP00000035843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]