SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035981 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035981
Domain Number 1 Region: 157-245
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 7.32e-19
Family Translation initiation factor IF3, C-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 79-145
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000262
Family Translation initiation factor IF3, N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035981   Gene: ENSCJAG00000019378   Transcript: ENSCJAT00000037996
Sequence length 280
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:140437700:140548978:-1 gene:ENSCJAG00000019378 transcript:ENSCJAT00000037996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSLKRLTLQAIKSEKSCIRCFGKHIVQKTAPAQSTPIASAPRFSFLVHAKAFSTTED
TQNEGKSKKKNGTAFSNTGRKISQRIIHVFDEKGNDLGNMHRADVIKLMEKQELRLVQRN
ASAEPAEYQLMTGVQIHQERLRLRDMGKANPKTGPTLTKELTFSSNIGQNDLDTKTKHIQ
QWIKKQHQVRITIKKGKNVDESENKGEDIFHQILQTMPGIATFSSRPQAVHGGKALMCVL
RPLSEKEEKAYKETQELQERDTLNKEHGNDKESNTLHQQF
Download sequence
Identical sequences F7E1Z4
ENSCJAP00000035981 ENSCJAP00000035981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]