SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035996 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035996
Domain Number 1 Region: 19-122
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1.02e-33
Family RBP11/RpoL 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035996   Gene: ENSCJAG00000019386   Transcript: ENSCJAT00000038011
Sequence length 133
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:140618933:140620514:1 gene:ENSCJAG00000019386 transcript:ENSCJAT00000038011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIM
KNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQRGLNELMNVCQHVLDKFEASIKN
YKEQKASRNESTF
Download sequence
Identical sequences F7DLJ3
ENSCJAP00000035996 ENSCJAP00000042868 XP_002748958.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]