SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036048 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036048
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000173
Family VPS37 C-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036048   Gene: ENSCJAG00000019419   Transcript: ENSCJAT00000038066
Sequence length 357
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:116456409:116465526:-1 gene:ENSCJAG00000019419 transcript:ENSCJAT00000038066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEELQNDSEAIDRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKTKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLEDFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPPP
RPVPQATPPVVEEQPQPPSSAMPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYS
GPLGPTYPAAQPGPRAAAGYSWSPQRSMPPRPGYPGTPTGASGPGYPVTGGRLPSPGYPQ
QSLYPEAGGKPPYPIQPQLPGFPGQPKPSMPPQPPYPPGPAPPYGFPQPQGPAWPGY
Download sequence
Identical sequences F7GF89
XP_002755450.1.60252 ENSCJAP00000036048 ENSCJAP00000036048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]