SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036144 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036144
Domain Number 1 Region: 1028-1183,1221-1300
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-42
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 135-275,385-454
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.84e-28
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 578-724,758-805
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-26
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 1349-1546,1573-1598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-24
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036144   Gene: ENSCJAG00000019443   Transcript: ENSCJAT00000038170
Sequence length 1832
Comment pep:novel chromosome:C_jacchus3.2.1:5:82684464:82719467:-1 gene:ENSCJAG00000019443 transcript:ENSCJAT00000038170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPSLATVVPLGPECLRPFTRESLAAIEQRVVEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPMIYGDPPPEAIGIPLEDLDPYYCDKKTFIVLNKGKAIFRFSATPALYMLSPFSMV
RRGAIKGLGMGEMGMFIMITILTNCVFMTMSNPPPWSKNVEYTFTGIYTFESLIKILARG
FCVDDFTFLRDPWNWLDFSVIMMAYLTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRHKCVRWPPPFNDTNTTWYSNDSW
YGNDTWYGDAMWHTNDSWYANDTWNSHASWATNDTFDWDAYINDEGNFYFLEGSNDALLC
GNSSDAGHCPEGYECIKAGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAG
KTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDKEKEEEFQQMLEKFKKHQE
ELEKAKAAQALEGGEADGDPAHGKDCNGSLDTSPGEKEAPRQSGSGDSGISDAMEELEEA
HQKCPPWWYKCAHKVLIWNCCAPWVKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHY
PMTEHFDNXXXXHSVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSIIVTLSLVELGLAN
VQGLSVLRSFPLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQL
FGKSYKECVCKIASDCSLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLTV
FLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKWGISFAKAFLL
GLLHGKILSAKDIMLSLGEPIGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHVGLAD
GPPSSIELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDGKKPPQPLYDGN
SSVCSTADYKPPEEDPEEQAEENPEEQPEECFTEACVQRWPCLYVDISQGRGKKWWTLRR
ACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFIMEMLL
KWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSR
FEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDISE
VNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKEEQ
PQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKMRKDIFMTEEQKKYYNAM
KKLGSKKPQKPIPRPQNKIQAMVYDLVTKQVFDITIMILICLNMVTMMVETDDQSQLKVD
ILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGAHVLSEKYKRWFQ
CLPMSRTGTLVPILQVRKFRHKQVNHAAVLSLSLSLSLYIYIYIYIYIYIDTHTHTPMTF
ANSIENGALPSPTSSHTFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPSLENPGTSI
KGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETW
EKFDPDATQFIAYNRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDILFALT
KEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQ
RSMKQASYMYRHSHDGSGDDAPEKEGLLANTMGKMYGHENRNSSSQSPEEKGKAGDAGPA
MGLIPISPSDTAQPPEPLPGQTVRSGVKESLV
Download sequence
Identical sequences F7HJ79
ENSCJAP00000036144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]