SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036223 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036223
Domain Number 1 Region: 21-49,97-160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.01e-24
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 277-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-21
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036223   Gene: ENSCJAG00000019505   Transcript: ENSCJAT00000038256
Sequence length 383
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:104924656:104937855:1 gene:ENSCJAG00000019505 transcript:ENSCJAT00000038256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASRHPQARRCCPEALGKLFPGLCFLCFLVTYALVGAVLFSAIEDGQVLLAADDGEFEE
FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTDWSFLSSLFFCCTVFSTVGYG
YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRLQKSPFFTSPLSKWC
PQSLFKKKTDLKPADEAIPQIIINAEELPGPKPGTCPSRPSCSMELFERLRAQEKQNTLQ
LPPQTMERSSSCPELVLGRLSYSIISNLDEVGQQVEKLDIPLPIVVLIVFAYISCAAAIL
PFWETELDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIVGMEIVFIAFKLVQNR
LIDIYKNVMLFFVKGKFYCLVKK
Download sequence
Identical sequences F7G205
XP_002807512.3.60252 ENSCJAP00000036223 ENSCJAP00000036223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]