SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036344 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036344
Domain Number 1 Region: 232-291
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.02e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036344   Gene: ENSCJAG00000019571   Transcript: ENSCJAT00000038383
Sequence length 323
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:20764006:20774286:-1 gene:ENSCJAG00000019571 transcript:ENSCJAT00000038383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
RDRTHRLQPVPVPVPVPAPVAPAAPPRGGADTAGEHGGSRVPEVSDARKRGFALGAVGPG
LPTTTTPPPPVPQSLAPGGAETQPFREPGLRPRILLCAPPARPKPSAPPAPPAPPAPPES
TVRPPPPARPGESSYSSISHVIYNNHPDSSASPRKRPGEATAASSEIKALQQTRRLLANA
RERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNL
SFSECVQRCTRTLQAEGRAKKRK
Download sequence
Identical sequences F7GY04
ENSCJAP00000036344 ENSCJAP00000036344 XP_017819681.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]