SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036357 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036357
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily POZ domain 3.4e-23
Family BTB/POZ domain 0.0071
Further Details:      
 
Domain Number 2 Region: 229-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000769
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 3 Region: 340-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000797
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036357   Gene: ENSCJAG00000019576   Transcript: ENSCJAT00000038397
Sequence length 376
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:89394224:89415940:-1 gene:ENSCJAG00000019576 transcript:ENSCJAT00000038397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASHSLVLLQQLNMQREFGFLCDCTVAIGDVYFKAHRAVLAAFSNYFKMIFIHQTSEC
IKIQPTDIQPDIFSYLLHIMYTGKGPKQIVDHSRLEEGIRFLHADYLSHIATEMNQVFSP
ETVQSSNLYGIQISTTQKTVVKQGLEVKEAPSSNSGNRAAVQGDHPQLQLSLAIGLDDGT
ADQQRAHPATQALEEHQKPPVSIKQERCDPESVMSQSHPSPSLEVTGPTFTETSIKIHLC
HYCGERFDSRSNLRQHLHTHVSGSLPFGVPASILESNDLGEVHPLNENSEALECRRLSSF
IVKENEQQPDHSNRGTTEPLQISQVSLISKDTEPVELKKRKISCSICGHKFPRKSQLLEH
MYTHKGKSYRYNRCQR
Download sequence
Identical sequences F7GSY5
ENSCJAP00000036357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]