SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036724 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036724
Domain Number 1 Region: 154-256
Classification Level Classification E-value
Superfamily Cyclin-like 5.35e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 61-152
Classification Level Classification E-value
Superfamily Cyclin-like 1.17e-25
Family Transcription factor IIB (TFIIB), core domain 0.0046
Further Details:      
 
Domain Number 3 Region: 4-48
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000176
Family Transcriptional factor domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036724   Gene: ENSCJAG00000019730   Transcript: ENSCJAT00000038783
Sequence length 652
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:131264640:131345789:-1 gene:ENSCJAG00000019730 transcript:ENSCJAT00000038783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSL
DGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPH
MLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTA
LRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEF
EDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDA
IEIELESSRPKAKGGLASLAKDGSVEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLG
ATPGSSEAAGSPQGSGRPPALQSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGEL
DLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPK
KSCKRREPIQASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDARPQHSGSA
RKLSRRRTPASTSAADPVTSMGKRYRPVLSGWVSGQEPKVGREGLLPSSPALGAEPARPQ
AVLVESGPVSYHADEEAEEEEPDEEDGELCVSALQMMGGDDYGCDVDEDDGY
Download sequence
Identical sequences F6RFH8
ENSCJAP00000036724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]