SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036726 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036726
Domain Number 1 Region: 521-705
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.89e-45
Family cAMP-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.08e-43
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.93e-19
Family Flavin-binding PAS domain 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036726   Gene: ENSCJAG00000019748   Transcript: ENSCJAT00000038785
Sequence length 958
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:82244861:82267649:1 gene:ENSCJAG00000019748 transcript:ENSCJAT00000038785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QQPCTCDFLTGPNTPSSAVSRLAEALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAELLAKRSSRSLSQRLLSQSFLGSEGSHSRPGGPGLGTGRGKYRTISQ
IPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
VPRIHRWTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDESRRGACSYTCSPL
TVVDLIVDIMFVVDIIINFRTTYVNNNDEVVSHPRRIVVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEHKIGWLDSLGVQLGKRYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFSGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
VSLHAQPGKSSADVRALTYCDLHKIQRADLLEVLDMYPAFADSFWSKLEVTFNLREAAGG
LHSSPQQAPGSQDHQGFFLKDNQSDAAPPLSISDASAFWPELLQQMPPRHSAPGPKGDPE
CWPRKLGSRLEQLQAQMNRLESRMSSDLSRILQLLQQPMPQGHFSYILEAPASNDLALFP
IASETQSPGHRLPQDFLPSAQTLSCGNLDNCSPKHGNSFPGMPHLAVATDKSLAPSSEQE
QPEGLWPPLASPLHPLEVQGLICGPRFSSLPEQLGSVPKQLEFQRHGSDPGFAGSWGH
Download sequence
Identical sequences F6RFF7
ENSCJAP00000036726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]