SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036799 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036799
Domain Number 1 Region: 77-205,275-296,497-614
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.89e-33
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036799   Gene: ENSCJAG00000019778   Transcript: ENSCJAT00000038864
Sequence length 840
Comment pep:novel chromosome:C_jacchus3.2.1:12:4404850:4470201:-1 gene:ENSCJAG00000019778 transcript:ENSCJAT00000038864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFKVSKFRHMEARLPRREAWISDIRAGTAPSFRNHIKSSRSLIAFNSDCPGVLGIVPL
QGQGEDKRCVAHLGCHSELAAHGDLVQSAIWSRDGTLVGTACKDKQLRIFDPRAKPQTSQ
STEAHKNGRDSRLAWTGTQEHLVSTGFNQMREQEVKLWDTRLFSSALASLTLDTSPGYLL
PLLDPDSGLLVLAGKGERQLYCYEVVPQQPALSPVTQCVLESVLRGAALVPRQVLAVMSC
EVLRVLQLSDTAIVPISYHVPRKAVEFHEDLFPDTASCVPASDPHSWWAGDNQQVQKVSL
NPACRPYPSFTSRLVPPMEPLPNTAQPAVMKTPVGDADPSEDFSSPPSSLTSPSTPSSLG
PSLSSTSGIGTSPSLRSLQSLLGPCSKFRHAQGTVLHRDSHITNLKGLNLTTPGECDGFC
ANKLRVAVPLLSSGGQVAVLELQKPGRLPDTALPTLQNGAAVTDLTWDPFDPRRLAVGKE
AGCPGLRRVPPEGLEEVLTTPETVLTGHMEKICSLRFHPLAADVLASSSYDLTVRIWDLQ
AGVERLKLQGHRDQIFSLAWSPDGQQLATVCRDGRVRVYRPLSSPEPLQEGPGPKGGRGA
RIVWVCGGRCLLVSGFDSRSERQMLLYEAETLAGGPLAVLGLDVAPSTLLPSYDSDTGLV
LLTGKGDTRVFLYELLPESPFFLECNSFTSADPHKGFALLPKTECDVREVEFMRCLRLRQ
SSLEPVAFRLPRVRKEFFQDDVFPDTAVCWEPVLSAEAWLQGATGQPRLLSLQPPDMSPV
SQAPRETPARRAPSSAQYLEEKSDQQKKEELLNAMVAKLGNRDDPLPQDSFEGVDEDEWD
Download sequence
Identical sequences F6Q987
ENSCJAP00000036799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]