SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036837 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036837
Domain Number 1 Region: 375-508
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-42
Family C-type lectin domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 235-375
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-38
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 519-654
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 964-1111
Classification Level Classification E-value
Superfamily C-type lectin-like 6.13e-34
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 5 Region: 828-954
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-33
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 6 Region: 1258-1397
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 664-814
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-28
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 8 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.08e-25
Family Cysteine rich domain 0.005
Further Details:      
 
Domain Number 9 Region: 1133-1252
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-22
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 10 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036837   Gene: ENSCJAG00000019796   Transcript: ENSCJAT00000038904
Sequence length 1480
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:81315866:81375075:1 gene:ENSCJAG00000019796 transcript:ENSCJAT00000038904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGWPAPPSWPRHLLRCVLLLGGLHLGRPGAPGNAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSHPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGGRISNVSKPGTLERGDQTRSSQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAAPPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSIHS
MAELEFITKQIKQAPPEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLE
DCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGASEEDHGCRKGWTWHSPSCYWLGEDP
VTYSEARRLCTDHGSQLVTITNRFEQAFISSLMYTWDGEYFWTALQDLNRTGSFRWLSGD
EVMYTHWNRDQPGYSRGGCVALATGSSMGLWEVKNCTSFRARYICRQSLGTPVTPELPGP
DPTPSLTGSCSQGWASDPKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEE
EHFVANMLNKIFGESEPEVQEQHWFWIGLNRRDPRGGQSWRWSDGLGFSYHNFDRSRHDD
DDIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSSEGQQDWLHFQEAEYKF
FEHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNMQKFSRAQEQHWWIGLYTSEIDGR
FRWTDGSVINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTSLPYVCKRSNVSKET
QYSDLPATFEGGCSSGWLQFLNKCFKIEGRDPQSKVKWSEAQFYCEQQEAQLVTVATSLE
QAFITATLPNATLDLWIGLHASQREFQWVDREPVLYANWAPGEPSGPGPAPSGNKPTSCV
VMLHSPSAHFTGRWDDRSCTEETHGFICQKGTDLSLSPSLTALPPTSGSDLSYLNGTFRL
LQKPLRWHDALLLCESRNTSLAYVPDSYTQAFLVLAARGLHIPIWIGLAGEEGSRRYSWV
SEEPLSYVGWQEGEPQHLGGCTYVDVDGAWRTTSCDTRLQGAMCGIRNGSPPPRRISYHG
SCPQRLADSSWIPFREHCYSFHMELLLGHKEAQQRCQRAGGAVLSIQDEAENVFVWEYMQ
NYAGRNRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLW
RPGACTNITMGVICKLPRAQQNSFSPSALPENPAALVVVLMAVLLLLALVTAALILYRRR
QSSERGSFEGARYSRSSSSPAEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences F6TKD4
ENSCJAP00000036837 ENSCJAP00000036850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]