SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036851 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036851
Domain Number 1 Region: 378-507
Classification Level Classification E-value
Superfamily C-type lectin-like 8.76e-42
Family C-type lectin domain 0.0000893
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 518-653
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 4 Region: 963-1110
Classification Level Classification E-value
Superfamily C-type lectin-like 6.13e-34
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 5 Region: 827-953
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-33
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 6 Region: 1257-1396
Classification Level Classification E-value
Superfamily C-type lectin-like 2.82e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 663-813
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-28
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 8 Region: 41-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.08e-25
Family Cysteine rich domain 0.005
Further Details:      
 
Domain Number 9 Region: 1132-1251
Classification Level Classification E-value
Superfamily C-type lectin-like 4.64e-22
Family C-type lectin domain 0.0033
Further Details:      
 
Domain Number 10 Region: 172-230
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036851   Gene: ENSCJAG00000019796   Transcript: ENSCJAT00000038918
Sequence length 1479
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:81315866:81375075:1 gene:ENSCJAG00000019796 transcript:ENSCJAT00000038918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGWPAPPSWPRHLLRCVLLLGGLHLGRPGAPGNAALPEPNVFLIFSHGLQGCLEAQGG
QVRVTPACNTSHPAQRWKWVSRNRLFNLGTMQCLGTGWPGTNTTASLGMYECDREALNLR
WHCRTLGDQLSLLLGGRISNVSKPGTLERGDQTRSSQWRIYGSEEDLCALPYHEVYTIQG
NSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWD
KDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGL
NDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCK
KKPNATAAPPGPDRWANVKVECEPSWQPFQGHCYRLQAEKRSWQESKKACLRGGGDLVSI
HSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLED
CVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGASEEDHGCRKGWTWHSPSCYWLGEDPV
TYSEARRLCTDHGSQLVTITNRFEQAFISSLMYTWDGEYFWTALQDLNRTGSFRWLSGDE
VMYTHWNRDQPGYSRGGCVALATGSSMGLWEVKNCTSFRARYICRQSLGTPVTPELPGPD
PTPSLTGSCSQGWASDPKLRYCYKVFSSERLQDKKSWVQAQGACQELGAQLLSLASYEEE
HFVANMLNKIFGESEPEVQEQHWFWIGLNRRDPRGGQSWRWSDGLGFSYHNFDRSRHDDD
DIRGCAVLDLASLQWVAMQCDTQLDWICKIPRGTDVREPDDSSEGQQDWLHFQEAEYKFF
EHHSTWAQAQRICTWFQAELTSVHSQAELDFLSHNMQKFSRAQEQHWWIGLYTSEIDGRF
RWTDGSVINFISWAPGKPRPVGKDKKCVYMTASREDWGDQRCLTSLPYVCKRSNVSKETQ
YSDLPATFEGGCSSGWLQFLNKCFKIEGRDPQSKVKWSEAQFYCEQQEAQLVTVATSLEQ
AFITATLPNATLDLWIGLHASQREFQWVDREPVLYANWAPGEPSGPGPAPSGNKPTSCVV
MLHSPSAHFTGRWDDRSCTEETHGFICQKGTDLSLSPSLTALPPTSGSDLSYLNGTFRLL
QKPLRWHDALLLCESRNTSLAYVPDSYTQAFLVLAARGLHIPIWIGLAGEEGSRRYSWVS
EEPLSYVGWQEGEPQHLGGCTYVDVDGAWRTTSCDTRLQGAMCGIRNGSPPPRRISYHGS
CPQRLADSSWIPFREHCYSFHMELLLGHKEAQQRCQRAGGAVLSIQDEAENVFVWEYMQN
YAGRNRGAWLGMNFNPKGGTLVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSNSGLWR
PGACTNITMGVICKLPRAQQNSFSPSALPENPAALVVVLMAVLLLLALVTAALILYRRRQ
SSERGSFEGARYSRSSSSPAEATEKNILVSDMEMNEQQE
Download sequence
Identical sequences F6T959
ENSCJAP00000036851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]