SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036878 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036878
Domain Number 1 Region: 30-205
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 9.16e-48
Family Peptidyl-tRNA hydrolase-like 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036878   Gene: ENSCJAG00000019841   Transcript: ENSCJAT00000038947
Sequence length 214
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:171636435:171638118:-1 gene:ENSCJAG00000019841 transcript:ENSCJAT00000038947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPHGLLRSGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRL
GVAESWTRDRHCAADLALALLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVH
DELDKPLGKLALKLGGSARGHNGVRSCINCLNSNAMPRLRVGIGRPTHPEAVQAHVLGSF
SPAEQELLPLLLDRAADLILDHIRERSQGPSLGP
Download sequence
Identical sequences F6SY06
ENSCJAP00000036878 ENSCJAP00000036878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]