SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036931 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036931
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.2e-78
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1305-1419
Classification Level Classification E-value
Superfamily E set domains 1.27e-35
Family Filamin repeat (rod domain) 0.00000234
Further Details:      
 
Domain Number 3 Region: 1398-1515
Classification Level Classification E-value
Superfamily E set domains 2.47e-35
Family Filamin repeat (rod domain) 0.00000412
Further Details:      
 
Domain Number 4 Region: 1216-1327
Classification Level Classification E-value
Superfamily E set domains 1.4e-31
Family Filamin repeat (rod domain) 0.00000088
Further Details:      
 
Domain Number 5 Region: 1494-1611
Classification Level Classification E-value
Superfamily E set domains 7.34e-31
Family Filamin repeat (rod domain) 0.0000291
Further Details:      
 
Domain Number 6 Region: 1592-1707
Classification Level Classification E-value
Superfamily E set domains 1.2e-30
Family Filamin repeat (rod domain) 0.0000039
Further Details:      
 
Domain Number 7 Region: 1038-1127
Classification Level Classification E-value
Superfamily E set domains 4.4e-30
Family Filamin repeat (rod domain) 0.00000391
Further Details:      
 
Domain Number 8 Region: 430-547
Classification Level Classification E-value
Superfamily E set domains 1.53e-29
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 9 Region: 1110-1225
Classification Level Classification E-value
Superfamily E set domains 5.74e-29
Family Filamin repeat (rod domain) 0.00000415
Further Details:      
 
Domain Number 10 Region: 1817-1912
Classification Level Classification E-value
Superfamily E set domains 2e-28
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 11 Region: 823-943
Classification Level Classification E-value
Superfamily E set domains 2.6e-28
Family Filamin repeat (rod domain) 0.00044
Further Details:      
 
Domain Number 12 Region: 341-451
Classification Level Classification E-value
Superfamily E set domains 1.93e-27
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 13 Region: 252-365
Classification Level Classification E-value
Superfamily E set domains 2.74e-27
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 14 Region: 2188-2284
Classification Level Classification E-value
Superfamily E set domains 5.34e-27
Family Filamin repeat (rod domain) 0.00000992
Further Details:      
 
Domain Number 15 Region: 741-856
Classification Level Classification E-value
Superfamily E set domains 8.01e-27
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 16 Region: 1998-2093
Classification Level Classification E-value
Superfamily E set domains 1.67e-26
Family Filamin repeat (rod domain) 0.00000323
Further Details:      
 
Domain Number 17 Region: 643-752
Classification Level Classification E-value
Superfamily E set domains 1.73e-26
Family Filamin repeat (rod domain) 0.00064
Further Details:      
 
Domain Number 18 Region: 2511-2601
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.0000165
Further Details:      
 
Domain Number 19 Region: 2382-2473
Classification Level Classification E-value
Superfamily E set domains 1.73e-24
Family Filamin repeat (rod domain) 0.0000148
Further Details:      
 
Domain Number 20 Region: 536-639
Classification Level Classification E-value
Superfamily E set domains 3.2e-24
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 21 Region: 2289-2380
Classification Level Classification E-value
Superfamily E set domains 5.6e-24
Family Filamin repeat (rod domain) 0.0000166
Further Details:      
 
Domain Number 22 Region: 2110-2205
Classification Level Classification E-value
Superfamily E set domains 6.67e-21
Family Filamin repeat (rod domain) 0.00001
Further Details:      
 
Domain Number 23 Region: 951-1049
Classification Level Classification E-value
Superfamily E set domains 1.97e-20
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 24 Region: 1908-1996
Classification Level Classification E-value
Superfamily E set domains 5.87e-18
Family Filamin repeat (rod domain) 0.00000529
Further Details:      
 
Domain Number 25 Region: 1755-1831
Classification Level Classification E-value
Superfamily E set domains 3e-16
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036931   Gene: ENSCJAG00000019764   Transcript: ENSCJAT00000039004
Sequence length 2602
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:34054287:34225426:1 gene:ENSCJAG00000019764 transcript:ENSCJAT00000039004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRENIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNSVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELSVAVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYSPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCSEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTIDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYAVEASLPPDPTKVKAHGPGLKGGFVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEVGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPTRVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
Download sequence
Identical sequences F6R327
XP_002758527.1.60252 ENSCJAP00000036931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]