SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036944 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036944
Domain Number 1 Region: 348-617
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.47e-86
Family Eukaryotic proteases 0.00000000139
Further Details:      
 
Domain Number 2 Region: 104-185
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-28
Family Kringle modules 0.0000397
Further Details:      
 
Domain Number 3 Region: 209-304
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-28
Family Kringle modules 0.0000153
Further Details:      
 
Domain Number 4 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 1.31e-19
Family GLA-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036944   Gene: ENSCJAG00000019864   Transcript: ENSCJAT00000039017
Sequence length 621
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:109989726:110012704:1 gene:ENSCJAG00000019864 transcript:ENSCJAT00000039017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQALSLLPRARRANSGFLEEMRQGNLERE
CIEEICSYEEAFEALESRTDTDVFWTKYKACELVRTPREKLVACLEGNCAEGLGTNYRGH
VNVTASGIECQLWRSRINTTTHPETDLQENFCRNPDSSTMGPWCYTTDPTVRREECSIPV
CVLPHTPGEDRVTVAMTPRSRGSGNLSPPSEWCVPDRGRQYQGRLAVTASGLPCLAWASP
QAKALSKNQDFSSAVPLVENFCRNPDGDEEGAWCYVAGRPGDFEYCDLNYCEDAVDEEPG
YGPGEDPEGAIQGRTSINDYQTFFNPGTFGSGESDCGLRPLFEKKLLKDKTEKELLESYI
DGRIVEGWDAEIGISPWQVMLFRKAPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHARTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPITFSDYIHP
VCLPDRETAASLLQSGYLGRVTGWGNLKETWTASGKVLPSVLQVVNLPIVERPVCKASTR
IRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKNPSNNRWYQMGIVSWGEGCDRDGKYG
FYTHVFRLKKWIKKVIDQFGE
Download sequence
Identical sequences F6QU78
ENSCJAP00000036947 ENSCJAP00000036944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]