SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037043 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037043
Domain Number 1 Region: 16-89
Classification Level Classification E-value
Superfamily POZ domain 0.00000000157
Family Tetramerization domain of potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037043   Gene: ENSCJAG00000019925   Transcript: ENSCJAT00000039121
Sequence length 242
Comment pep:novel chromosome:C_jacchus3.2.1:18:263633:264663:1 gene:ENSCJAG00000019925 transcript:ENSCJAT00000039121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGSTRGLPNWGXDIVQLNVGVQVCGTRRGTSVLVPDSPLWRVFTQQPPQELARDSRG
RSFDRDGFVFRYIPDYMRDWQLVLPDCFPDYFGPGRPEGASARAPSPTLELAGRSPSLTV
SLSLDGSRRSGYITIGYRGSHTIGRDARADAKFRRVARITVCRETSLAKEVFGDALNESR
DPDPPERYHLKFSFLEQFDELSESGFHRVACSSTDTCAFASSTDQSEDKSWTSYTQHVFC
RE
Download sequence
Identical sequences F6YJG3
ENSCJAP00000037043 ENSCJAP00000037043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]