SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037086 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037086
Domain Number 1 Region: 516-846
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-106
Family PDEase 0.00000128
Further Details:      
 
Domain Number 2 Region: 248-349
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.16e-17
Family Flavin-binding PAS domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037086
Domain Number - Region: 122-194
Classification Level Classification E-value
Superfamily CheY-like 0.00123
Family CheY-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037086   Gene: ENSCJAG00000019876   Transcript: ENSCJAT00000039165
Sequence length 858
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:130938477:131156692:-1 gene:ENSCJAG00000019876 transcript:ENSCJAT00000039165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVSQSGVIYCRDSDESNFSHQTTSVSQGPAAPLPGLFVQTDAADAIPPSRASGPPSAARV
RRARAELGSGSSAGSAAPAATTSRGRRRHCCSSAEAETQTSYTSVKVLLIFAKEDSQSDG
FWWACDRAGYRCNIARTPESALECFLDKHHEIIVIDHRQTQNFDAEAVCRSIRATNPSEH
TVILAVVSRVSDDHEEASVLPLLHAGFNRRFMENSSIIACYNELIQIEHGEVRSQFKLRA
CNSVFTALDHCHEAIEITSDDHVIQYVNPAFERMMGYHKGELLGKELADLPKSDKNRADL
LDTINTCIKKGKEWQGVYYARRKSGDSIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNN
KQIHKIHRDSGDNSQTEPHSFRYKNRRKESIDVKSISSRGSDAPSLQNRRYPSMARIHSM
TIEAPITKVINIINAAQENSPVTVAEALDRVLEILRTTELYSPQLGTKDEDPHTSDLVGG
LMTDGLRRLSGNEYVFTKNVHQSHSHLAMPITINDVPPCISQLLDNEESWDFNIFELEAV
THKRPLVYLGLKVFTRFGVCEFLNCSETTLRAWFQVIEANYHSSNAYHNSTHAADVLHAT
AFFLGKERVKGSLDQLDEVAALIAATVHDVDHPGRTNSFLCNAGSELAVLYNDTAVLESH
HTALAFQLTVKDTKCNIFKNIDRNHYRTLRQAIIDMVLATEMTKHFEHVNKFVNSINKPM
AAEIEGSDCECNPAGKNFPENQILIKRMMIKCADVANPCRPLDLCIEWAGRISEEYFAQT
DEEKRQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDAWDAFAHLPALMQHLADNYKH
WKTLDDLKCKSLRLPSDS
Download sequence
Identical sequences F6WPD5
ENSCJAP00000037086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]