SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037104 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037104
Domain Number 1 Region: 104-187
Classification Level Classification E-value
Superfamily E set domains 3.45e-20
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037104
Domain Number - Region: 194-241
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0414
Family HLH, helix-loop-helix DNA-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037104   Gene: ENSCJAG00000019921   Transcript: ENSCJAT00000039183
Sequence length 426
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:12130856:12333188:1 gene:ENSCJAG00000019921 transcript:ENSCJAT00000039183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRVLRHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRR
FQVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGA
MVIIIGDNFFDGLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGA
PGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQD
IILKRAADIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNNQGY
IRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANLGVPGSPGFLNGSPTGSPYG
IMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGNGNGFRAMTG
LVVPPM
Download sequence
Identical sequences F6UXU8
ENSCJAP00000037104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]