SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037130 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037130
Domain Number 1 Region: 3-54
Classification Level Classification E-value
Superfamily LEM domain 0.000000000353
Family LEM domain 0.0032
Further Details:      
 
Domain Number 2 Region: 263-387
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000398
Family Ankyrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000037130
Domain Number - Region: 152-186
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0267
Family N-terminal domain of RNase HI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037130   Gene: ENSCJAG00000019963   Transcript: ENSCJAT00000039209
Sequence length 579
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01179358.1:3707:5476:-1 gene:ENSCJAG00000019963 transcript:ENSCJAT00000039209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMDTVLARLKLLNPDDLREEIIKAGLKSGPITSTTRFIFEKTLAQVLLKQGRRLPSFDH
HEAAAIALRQDTQRILKSAERNPTDQAGFSEDRDCGYSVSLNSPEEKLTSKTCSLSPSTV
DAQSWGTEFMEPPLYYGVCPVYEDVPARHERIHVYVNQKEALQAVKMIKGSRFKAFSTRE
AAEKFARGICDYFFSPSKTSLPLSPVKIAPLFSNDESKDGLCLSESESKQRASQQQDLTA
KLRKAAEKGEEDIFSDLIRGNPRYLIGSGDDPTIVQEGCRYNVMHVAAKEDQAFICQLTL
DVLENPDFMRLMYPDDDEAVLQKRIRYVVDLYLNTPDKMGYDTPLHFACKFGNADLVNVL
SSHQLTVKNPRNKYAKTPEDVICERSKNKSELKERIREYLKGHYVPLLRAEDTSSPVIGE
LWSSDQTAKASRVGRYGGSPRDPVLTLRAFAGPLRPAKVEDFRKLLKTPPREKAGFLHNF
KKSDLKRGLERVWRELAHELGYPWVEYWQFLGCFVDLSSQEGLQRLEDYLTQQEIGKNAQ
QETGEREACRDEATTSGSNAISMSAFLDEDDMSLEEIKN
Download sequence
Identical sequences H9KXJ8
ENSCJAP00000037130 ENSCJAP00000037130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]