SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037166 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037166
Domain Number 1 Region: 219-381
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.12e-43
Family Pentapeptide repeats 0.00024
Further Details:      
 
Domain Number 2 Region: 89-192
Classification Level Classification E-value
Superfamily POZ domain 2.94e-25
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 
Domain Number 3 Region: 2-76
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000432
Family Doublecortin (DC) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037166   Gene: ENSCJAG00000019969   Transcript: ENSCJAT00000039249
Sequence length 392
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:12665454:12693589:1 gene:ENSCJAG00000019969 transcript:ENSCJAT00000039249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDD
VLFVCEGEPFIDPQTDSKPPEGLSGFHTDWLTLNVGGRYFTTTRILRSTLVNKEPDSMLA
HMFKDKGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGI
DSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRY
INFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFED
PSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSG
CDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences F7B1A2
ENSCJAP00000037152 ENSCJAP00000037166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]